ASS1 Antikörper (N-Term)

Produktnummer ABIN629706

Dieses Anti-ASS1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ASS1 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für ASS1 Antikörper (N-Term) (ABIN629706)

Target: ASS1 (Argininosuccinate Synthase 1 (ASS1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ASS1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ASS1 antibody was raised against the N terminal Of Ass

Aufreinigung: Purified

Immunogen: ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASS1 Blocking Peptide, (ABIN936216), is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASS1

Target: ASS1 (Argininosuccinate Synthase 1 (ASS1))

Andere Bezeichnung: ASS1

Hintergrund: ASS catalyzes the penultimate step of the arginine biosynthetic pathway.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin