FDFT1 Antikörper (N-Term)

Produktnummer ABIN629705

Der Kaninchen Polyklonal anti-FDFT1 Antikörper wird verwendet zum Nachweis von FDFT1 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für FDFT1 Antikörper (N-Term) (ABIN629705)

Target: FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FDFT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FDFT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: FDFT1 antibody was raised against the N terminal of FDFT1

Aufreinigung: Purified

Immunogen: FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FDFT1 Blocking Peptide, (ABIN939238), is also available for use as a blocking control in assays to test for specificity of this FDFT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDFT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FDFT1

Target: FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))

Andere Bezeichnung: FDFT1

Hintergrund: FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha