RGS20 Antikörper (N-Term)

Produktnummer ABIN629702

Der Kaninchen Polyklonal Anti-RGS20-Antikörper wurde für WB validiert. Er ist geeignet, RGS20 in Proben von Human zu detektieren.

Kurzübersicht für RGS20 Antikörper (N-Term) (ABIN629702)

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RGS20 Antikörper

Bindungsspezifität: N-Term

Spezifität: RGS20 antibody was raised against the N terminal of RGS20

Aufreinigung: Purified

Immunogen: RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS20 Blocking Peptide, (ABIN939799), is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS20

Target: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Andere Bezeichnung: RGS20

Hintergrund: Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling