CDR2 Antikörper (N-Term)

Produktnummer ABIN629700

Dieses Anti-CDR2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CDR2 in IHC und WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für CDR2 Antikörper (N-Term) (ABIN629700)

Target: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDR2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-CDR2 Antikörper

Bindungsspezifität: N-Term

Spezifität: CDR2 antibody was raised against the N terminal of CDR2

Aufreinigung: Purified

Immunogen: CDR2 antibody was raised using the N terminal of CDR2 corresponding to a region with amino acids MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDR2 Blocking Peptide, (ABIN5612802), is also available for use as a blocking control in assays to test for specificity of this CDR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDR2

Target: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Andere Bezeichnung: CDR2

Hintergrund: Cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.

Molekulargewicht: 52 kDa (MW of target protein)