PNPLA5 Antikörper (N-Term)

Produktnummer ABIN629699

Der Kaninchen Polyklonal Anti-PNPLA5 Antikörper wurde für WB validiert. Er ist geeignet, PNPLA5 in Proben von Human zu detektieren.

Kurzübersicht für PNPLA5 Antikörper (N-Term) (ABIN629699)

Target: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNPLA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PNPLA5 Antikörper

Bindungsspezifität: N-Term

Spezifität: PNPLA5 antibody was raised against the N terminal of PNPLA5

Aufreinigung: Purified

Immunogen: PNPLA5 antibody was raised using the N terminal of PNPLA5 corresponding to a region with amino acids LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNPLA5 Blocking Peptide, (ABIN5615441), is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNPLA5

Target: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Andere Bezeichnung: PNPLA5

Hintergrund: Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.

Molekulargewicht: 48 kDa (MW of target protein)