PCK1 Antikörper (Soluble)

Produktnummer ABIN629697

Der Kaninchen Polyklonal anti-PCK1 Antikörper (ABIN629697) detektiert spezifisch PCK1 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Hund.

Kurzübersicht für PCK1 Antikörper (Soluble) (ABIN629697)

Target: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PCK1 Antikörper

Bindungsspezifität: Soluble

Aufreinigung: Purified

Immunogen: PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCK1 Blocking Peptide, (ABIN5615257), is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCK1

Target: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Andere Bezeichnung: PCK1

Hintergrund: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis