NDRG1 Antikörper (N-Term)

Produktnummer ABIN629694

Produktdetails anti-NDRG1 Antikörper

Target: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDRG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NDRG1 antibody was raised against the N terminal of NDRG1

Aufreinigung: Purified

Immunogen: NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDRG1 Blocking Peptide, catalog no. 33R-6485, is also available for use as a blocking control in assays to test for specificity of this NDRG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDRG1

Target: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Andere Bezeichnung: NDRG1 (NDRG1 Produkte)

Synonyme: CAP43 antikoerper, CMT4D antikoerper, DRG-1 antikoerper, DRG1 antikoerper, GC4 antikoerper, HMSNL antikoerper, NDR1 antikoerper, NMSL antikoerper, PROXY1 antikoerper, RIT42 antikoerper, RTP antikoerper, TARG1 antikoerper, TDD5 antikoerper, Ndr1 antikoerper, Ndrl antikoerper, cap43 antikoerper, cmt4d antikoerper, drg1 antikoerper, gc4 antikoerper, hmsnl antikoerper, ndr1 antikoerper, ndrg1 antikoerper, nmsl antikoerper, proxy1 antikoerper, rit42 antikoerper, rtp antikoerper, targ1 antikoerper, tdd5 antikoerper, xndrg1 antikoerper, ndrg4 antikoerper, cb775 antikoerper, wu:fb60h02 antikoerper, zgc:63944 antikoerper, NDRG1 antikoerper, NON-RACE SPECIFIC DISEASE RESISTANCE PROTEIN antikoerper, non race-specific disease resistance 1 antikoerper, ndrg1-a antikoerper, ndrg1-b antikoerper, xNDRG1-A antikoerper, ndrg1l antikoerper, zgc:73047 antikoerper, N-myc downstream regulated 1 antikoerper, N-myc downstream regulated gene 1 antikoerper, N-myc downstream regulated 1 S homeolog antikoerper, N-myc downstream regulated 1a antikoerper, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family antikoerper, N-myc downstream regulated 1 L homeolog antikoerper, N-myc downstream regulated 1b antikoerper, NDRG1 antikoerper, Ndrg1 antikoerper, ndrg1.S antikoerper, ndrg1 antikoerper, ndrg1a antikoerper, NDR1 antikoerper, ndrg1.L antikoerper, ndrg1b antikoerper

Hintergrund: NDRG1 is a member of the N-myc downregulated protein family which belongs to the alpha/beta hydrolase superfamily. NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in its gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.

Molekulargewicht: 43 kDa (MW of target protein)