NDRG1 Antikörper (N-Term)

Produktnummer ABIN629694

Dieses Anti-NDRG1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NDRG1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für NDRG1 Antikörper (N-Term) (ABIN629694)

Target: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDRG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NDRG1 Antikörper

Bindungsspezifität: N-Term

Spezifität: NDRG1 antibody was raised against the N terminal of NDRG1

Aufreinigung: Purified

Immunogen: NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDRG1 Blocking Peptide, (ABIN5614939), is also available for use as a blocking control in assays to test for specificity of this NDRG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDRG1

Target: NDRG1 (N-Myc Downstream Regulated 1 (NDRG1))

Andere Bezeichnung: NDRG1

Hintergrund: NDRG1 is a member of the N-myc downregulated protein family which belongs to the alpha/beta hydrolase superfamily. NDRG1 is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in its gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.

Molekulargewicht: 43 kDa (MW of target protein)