MDH1 Antikörper

Produktnummer ABIN629689

Produktdetails anti-MDH1 Antikörper

Target: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Reaktivität: Human, Maus, Ratte, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: MDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MDH1 Blocking Peptide, catalog no. 33R-6690, is also available for use as a blocking control in assays to test for specificity of this MDH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MDH1

Target: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Andere Bezeichnung: MDH1 (MDH1 Produkte)

Synonyme: MDH-s antikoerper, MDHA antikoerper, MGC:1375 antikoerper, MOR2 antikoerper, ODS1 antikoerper, B230377B03Rik antikoerper, D17921 antikoerper, Mor-2 antikoerper, Mor2 antikoerper, MDL1 antikoerper, Mdhl antikoerper, MDH antikoerper, mdh-s antikoerper, mdha antikoerper, mor2 antikoerper, MDH-1 antikoerper, Mdh antikoerper, Mdh-1 antikoerper, Mdh2 antikoerper, MdhD antikoerper, cMdh antikoerper, sMdh antikoerper, malate dehydrogenase 1 antikoerper, malic enzyme 2 antikoerper, malate dehydrogenase 1, NAD (soluble) antikoerper, malate dehydrogenase 1 S homeolog antikoerper, malate dehydrogenase, cytoplasmic antikoerper, Malate dehydrogenase 1 antikoerper, MDH1 antikoerper, ME2 antikoerper, Mdh1 antikoerper, mdh1.S antikoerper, LOC100280767 antikoerper

Hintergrund: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Molekulargewicht: 36 kDa (MW of target protein)