MDH1 Antikörper

Produktnummer ABIN629689

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MDH1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Arabidopsis.

Kurzübersicht für MDH1 Antikörper (ABIN629689)

Target: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Reaktivität: Human, Maus, Ratte, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MDH1 Antikörper

Aufreinigung: Purified

Immunogen: MDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MDH1 Blocking Peptide, (ABIN5614711), is also available for use as a blocking control in assays to test for specificity of this MDH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MDH1

Target: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Andere Bezeichnung: MDH1

Hintergrund: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Molekulargewicht: 36 kDa (MW of target protein)