DLAT Antikörper

Produktnummer ABIN629688

Produktdetails anti-DLAT Antikörper

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: DLAT antibody was raised using a synthetic peptide corresponding to a region with amino acids WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLAT Blocking Peptide, catalog no. 33R-10028, is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLAT

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Andere Bezeichnung: DLAT (DLAT Produkte)

Synonyme: DLAT antikoerper, Dmel\\CG5261 antikoerper, EP(2)0816 antikoerper, EP816 antikoerper, anon-WO0118547.121 antikoerper, DLTA antikoerper, PDC-E2 antikoerper, PDCE2 antikoerper, wu:fc14f10 antikoerper, wu:fc21f08 antikoerper, wu:fc86g11 antikoerper, wu:fj57d06 antikoerper, 6332404G05Rik antikoerper, midline uncoordinated antikoerper, dihydrolipoamide S-acetyltransferase L homeolog antikoerper, dihydrolipoamide S-acetyltransferase antikoerper, dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) antikoerper, muc antikoerper, dlat.L antikoerper, DLAT antikoerper, Dlat antikoerper, dlat antikoerper

Hintergrund: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Molekulargewicht: 71 kDa (MW of target protein)