DLAT Antikörper

Produktnummer ABIN629688

Dieses Anti-DLAT-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DLAT in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für DLAT Antikörper (ABIN629688)

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-DLAT Antikörper

Aufreinigung: Purified

Immunogen: DLAT antibody was raised using a synthetic peptide corresponding to a region with amino acids WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLAT Blocking Peptide, (ABIN935982), is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLAT

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Andere Bezeichnung: DLAT

Hintergrund: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Molekulargewicht: 71 kDa (MW of target protein)