GOT1 Antikörper
-
- Target Alle GOT1 Antikörper anzeigen
- GOT1 (Glutamic-Oxaloacetic Transaminase 1, Soluble (Aspartate Aminotransferase 1) (GOT1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GOT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
- Top Product
- Discover our top product GOT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GOT1 Blocking Peptide, catalog no. 33R-5715, is also available for use as a blocking control in assays to test for specificity of this GOT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GOT1 (Glutamic-Oxaloacetic Transaminase 1, Soluble (Aspartate Aminotransferase 1) (GOT1))
- Andere Bezeichnung
- GOT1 (GOT1 Produkte)
- Synonyme
- ASTQTL1 antikoerper, GIG18 antikoerper, cAspAT antikoerper, cCAT antikoerper, AST antikoerper, ISSD antikoerper, NSD antikoerper, SD antikoerper, SIALIN antikoerper, SIASD antikoerper, SLD antikoerper, xr406 antikoerper, CASPAT antikoerper, ASPARTATE AMINOTRANSFERASE antikoerper, ATAAT antikoerper, MATERNAL EFFECT EMBRYO ARREST 17 antikoerper, MEE17 antikoerper, T26C19.9 antikoerper, T26C19_9 antikoerper, aspartate aminotransferase antikoerper, aatA antikoerper, 83.t00021 antikoerper, AI789014 antikoerper, Got-1 antikoerper, Aspat antikoerper, Gaspat antikoerper, AL022787 antikoerper, FABP-pm antikoerper, Got-2 antikoerper, mAspAT antikoerper, ASPATA antikoerper, glutamic-oxaloacetic transaminase 1 antikoerper, solute carrier family 17 member 5 antikoerper, glutamic-oxaloacetic transaminase 1 homeolog antikoerper, aspartate aminotransferase antikoerper, glutamic-oxaloacetic transaminase 1, soluble antikoerper, glutamic-oxaloacetic transaminase 2 antikoerper, glutamatic-oxaloacetic transaminase 2, mitochondrial antikoerper, GOT1 antikoerper, SLC17A5 antikoerper, got1.S antikoerper, AAT antikoerper, aspC antikoerper, EHI_006080 antikoerper, AST2 antikoerper, ast2 antikoerper, got1 antikoerper, Got1 antikoerper, GOT2 antikoerper, Got2 antikoerper
- Hintergrund
- Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Hepatitis C, Monocarboxylic Acid Catabolic Process, Methionine Biosynthetic Process
-