CROT Antikörper (N-Term)

Produktnummer ABIN629682

Produktdetails anti-CROT Antikörper

Target: CROT (Carnitine O-Octanoyltransferase (CROT))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CROT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CROT antibody was raised against the N terminal of CROT

Aufreinigung: Purified

Immunogen: CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CROT Blocking Peptide, catalog no. 33R-5938, is also available for use as a blocking control in assays to test for specificity of this CROT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CROT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CROT

Target: CROT (Carnitine O-Octanoyltransferase (CROT))

Andere Bezeichnung: CROT (CROT Produkte)

Synonyme: CROT antikoerper, cot antikoerper, zgc:110643 antikoerper, COT antikoerper, 1200003H03Rik antikoerper, carnitine O-octanoyltransferase antikoerper, CROT antikoerper, crot antikoerper, Crot antikoerper

Hintergrund: Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process