CROT Antikörper (N-Term)
-
- Target Alle CROT Antikörper anzeigen
- CROT (Carnitine O-Octanoyltransferase (CROT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CROT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CROT antibody was raised against the N terminal of CROT
- Aufreinigung
- Purified
- Immunogen
- CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK
- Top Product
- Discover our top product CROT Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CROT Blocking Peptide, catalog no. 33R-5938, is also available for use as a blocking control in assays to test for specificity of this CROT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CROT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CROT (Carnitine O-Octanoyltransferase (CROT))
- Andere Bezeichnung
- CROT (CROT Produkte)
- Hintergrund
- Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-