ALDH4A1 Antikörper (C-Term)

Produktnummer ABIN629679

Dieses Anti-ALDH4A1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ALDH4A1 in WB und IHC. Geeignet für Human, Maus, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für ALDH4A1 Antikörper (C-Term) (ABIN629679)

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Reaktivität: Human, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH4A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ALDH4A1 Antikörper

Bindungsspezifität: C-Term

Spezifität: ALDH4 A1 antibody was raised against the C terminal of ALDH4 1

Aufreinigung: Purified

Immunogen: ALDH4 A1 antibody was raised using the C terminal of ALDH4 1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH4A1 Blocking Peptide, (ABIN5612012), is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH4A1

Target: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Andere Bezeichnung: ALDH4A1

Hintergrund: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process