S100A3 Antikörper (N-Term)

Produktnummer ABIN629669

Der Kaninchen Polyklonal Anti-S100A3-Antikörper wurde für WB und IHC validiert. Er ist geeignet, S100A3 in Proben von Human zu detektieren.

Kurzübersicht für S100A3 Antikörper (N-Term) (ABIN629669)

Target: S100A3 (S100 Calcium Binding Protein A3 (S100A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser S100A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-S100A3 Antikörper

Bindungsspezifität: N-Term

Spezifität: S100 A3 antibody was raised against the N terminal of S100 3

Aufreinigung: Purified

Immunogen: S100 A3 antibody was raised using the N terminal of S100 3 corresponding to a region with amino acids MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

S100A3 Blocking Peptide, (ABIN5615988), is also available for use as a blocking control in assays to test for specificity of this S100A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu S100A3

Target: S100A3 (S100 Calcium Binding Protein A3 (S100A3))

Andere Bezeichnung: S100A3

Hintergrund: S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

Molekulargewicht: 11 kDa (MW of target protein)

Pathways: S100 Proteine