CKMT2 Antikörper

Produktnummer ABIN629666

Produktdetails anti-CKMT2 Antikörper

Target: CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CKMT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CKMT2 Blocking Peptide, catalog no. 33R-3621, is also available for use as a blocking control in assays to test for specificity of this CKMT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKMT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CKMT2

Target: CKMT2 (Creatine Kinase, Mitochondrial 2 (Sarcomeric) (CKMT2))

Andere Bezeichnung: CKMT2 (CKMT2 Produkte)

Synonyme: 2300008A19Rik antikoerper, ScCKmit antikoerper, MIBCK antikoerper, SMTCK antikoerper, ckmt2-2 antikoerper, zgc:73059 antikoerper, CKMT2 antikoerper, Mib-CK antikoerper, S-MtCK antikoerper, creatine kinase, mitochondrial 2 antikoerper, creatine kinase, mitochondrial 2 (sarcomeric) antikoerper, creatine kinase, mitochondrial 2b (sarcomeric) antikoerper, CKMT2 antikoerper, ckmt2 antikoerper, Ckmt2 antikoerper, ckmt2b antikoerper

Hintergrund: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes.

Molekulargewicht: 46 kDa (MW of target protein)