MTHFD2 Antikörper

Produktnummer ABIN629664

Produktdetails anti-MTHFD2 Antikörper

Target: MTHFD2 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTHFD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTHFD2 Blocking Peptide, catalog no. 33R-5273, is also available for use as a blocking control in assays to test for specificity of this MTHFD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTHFD2

Target: MTHFD2 (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2))

Andere Bezeichnung: MTHFD2 (MTHFD2 Produkte)

Synonyme: nmdmc antikoerper, AW558851 antikoerper, NMDMC antikoerper, wu:fb38b11 antikoerper, wu:fe12e11 antikoerper, zgc:91891 antikoerper, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase L homeolog antikoerper, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase antikoerper, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like S homeolog antikoerper, methylenetetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase antikoerper, mthfd2.L antikoerper, MTHFD2 antikoerper, mthfd2 antikoerper, mthfd2l.S antikoerper, Mthfd2 antikoerper

Hintergrund: MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.

Molekulargewicht: 35 kDa (MW of target protein)