MDH2 Antikörper

Produktnummer ABIN629663

Der Kaninchen Polyklonal anti-MDH2 Antikörper wird verwendet zum Nachweis von MDH2 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für MDH2 Antikörper (ABIN629663)

Target: MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MDH2 Antikörper

Aufreinigung: Purified

Immunogen: MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MDH2 Blocking Peptide, (ABIN5614712), is also available for use as a blocking control in assays to test for specificity of this MDH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MDH2

Target: MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))

Andere Bezeichnung: MDH2

Hintergrund: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle.

Molekulargewicht: 33 kDa (MW of target protein)