PDSS1 Antikörper

Produktnummer ABIN629662

Produktdetails anti-PDSS1 Antikörper

Target: PDSS1 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 1 (PDSS1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDSS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDSS1 Blocking Peptide, catalog no. 33R-3225, is also available for use as a blocking control in assays to test for specificity of this PDSS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDSS1

Target: PDSS1 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 1 (PDSS1))

Andere Bezeichnung: PDSS1 (PDSS1 Produkte)

Synonyme: COQ1 antikoerper, COQ10D2 antikoerper, DPS antikoerper, RP13-16H11.3 antikoerper, SPS antikoerper, TPRT antikoerper, TPT antikoerper, TPT 1 antikoerper, hDPS1 antikoerper, 2610203G20Rik antikoerper, 2700031G06Rik antikoerper, Tprt antikoerper, mDLP1 antikoerper, mSPS1 antikoerper, tprt antikoerper, wu:fc11f12 antikoerper, wu:fd05d05 antikoerper, zgc:112058 antikoerper, T30F21.15 antikoerper, T30F21_15 antikoerper, solanesyl diphosphate synthase 1 antikoerper, decaprenyl diphosphate synthase subunit 1 antikoerper, prenyl (solanesyl) diphosphate synthase, subunit 1 antikoerper, prenyl (decaprenyl) diphosphate synthase, subunit 1 antikoerper, solanesyl diphosphate synthase 1 antikoerper, PDSS1 antikoerper, Pdss1 antikoerper, pdss1 antikoerper, SPS1 antikoerper

Hintergrund: PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.

Molekulargewicht: 46 kDa (MW of target protein)