AK4 Antikörper (Middle Region)

Produktnummer ABIN629661

Dieses Anti-AK4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von AK4 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für AK4 Antikörper (Middle Region) (ABIN629661)

Target: AK4 (Adenylate Kinase 4 (AK4))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AK4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: AK3 L1 antibody was raised against the middle region of AK3 1

Aufreinigung: Purified

Immunogen: AK3 L1 antibody was raised using the middle region of AK3 1 corresponding to a region with amino acids RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AK3L1 Blocking Peptide, (ABIN5611986), is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AK4

Target: AK4 (Adenylate Kinase 4 (AK4))

Andere Bezeichnung: AK3L1

Hintergrund: AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process