ACAT2 Antikörper

Produktnummer ABIN629656

Produktdetails anti-ACAT2 Antikörper

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACAT2 Blocking Peptide, catalog no. 33R-9686, is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACAT2

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Andere Bezeichnung: ACAT2 (ACAT2 Produkte)

Synonyme: fb10a06 antikoerper, fb53f08 antikoerper, wu:fb10a06 antikoerper, wu:fb53f08 antikoerper, AW742799 antikoerper, Tcp-1x antikoerper, Tcp1-rs1 antikoerper, Ab2-076 antikoerper, Acat3 antikoerper, EMB1276 antikoerper, EMBRYO DEFECTIVE 1276 antikoerper, MIF21.12 antikoerper, MIF21_12 antikoerper, acetoacetyl-CoA thiolase 2 antikoerper, acetyl-CoA acetyltransferase 2 antikoerper, acetyl-Coenzyme A acyltransferase 2 antikoerper, acetyl-Coenzyme A acetyltransferase 2 antikoerper, acetyl-CoA acetyltransferase 2 S homeolog antikoerper, acetoacetyl-CoA thiolase 2 antikoerper, ACAT2 antikoerper, CNA05060 antikoerper, acat2 antikoerper, Acat2 antikoerper, acat2.S antikoerper

Hintergrund: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Molekulargewicht: 44 kDa (MW of target protein)