ACAT2 Antikörper

Produktnummer ABIN629656

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACAT2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ACAT2 Antikörper (ABIN629656)

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ACAT2 Antikörper

Aufreinigung: Purified

Immunogen: ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACAT2 Blocking Peptide, (ABIN5611885), is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACAT2

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Andere Bezeichnung: ACAT2

Hintergrund: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Molekulargewicht: 44 kDa (MW of target protein)