ACAT2 Antikörper
-
- Target Alle ACAT2 Antikörper anzeigen
- ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACAT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
- Top Product
- Discover our top product ACAT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACAT2 Blocking Peptide, catalog no. 33R-8745, is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))
- Andere Bezeichnung
- ACAT2 (ACAT2 Produkte)
- Synonyme
- fb10a06 antikoerper, fb53f08 antikoerper, wu:fb10a06 antikoerper, wu:fb53f08 antikoerper, AW742799 antikoerper, Tcp-1x antikoerper, Tcp1-rs1 antikoerper, Ab2-076 antikoerper, Acat3 antikoerper, EMB1276 antikoerper, EMBRYO DEFECTIVE 1276 antikoerper, MIF21.12 antikoerper, MIF21_12 antikoerper, acetoacetyl-CoA thiolase 2 antikoerper, acetyl-CoA acetyltransferase 2 antikoerper, acetyl-Coenzyme A acyltransferase 2 antikoerper, acetyl-Coenzyme A acetyltransferase 2 antikoerper, acetyl-CoA acetyltransferase 2 S homeolog antikoerper, acetoacetyl-CoA thiolase 2 antikoerper, ACAT2 antikoerper, CNA05060 antikoerper, acat2 antikoerper, Acat2 antikoerper, acat2.S antikoerper
- Hintergrund
- Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
- Molekulargewicht
- 41 kDa (MW of target protein)
-