UPB1 Antikörper (Middle Region)

Produktnummer ABIN629651

Produktdetails anti-UPB1 Antikörper

Target: UPB1 (Ureidopropionase, beta (UPB1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Drosophila melanogaster, Arabidopsis, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UPB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UPB1 antibody was raised against the middle region of UPB1

Aufreinigung: Purified

Immunogen: UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UPB1 Blocking Peptide, catalog no. 33R-1619, is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UPB1

Target: UPB1 (Ureidopropionase, beta (UPB1))

Andere Bezeichnung: UPB1 (UPB1 Produkte)

Synonyme: MGC82230 antikoerper, wu:fb69e03 antikoerper, zgc:64020 antikoerper, BUP1 antikoerper, AI195023 antikoerper, Bup1 antikoerper, ureidopropionase, beta S homeolog antikoerper, beta-ureidopropionase 1 antikoerper, ureidopropionase, beta antikoerper, UreidoPropionase Beta antikoerper, upb1.S antikoerper, UPB1 antikoerper, upb1 antikoerper, upb-1 antikoerper, Upb1 antikoerper

Hintergrund: UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.

Molekulargewicht: 42 kDa (MW of target protein)