Asialoglycoprotein Receptor 1 Antikörper (N-Term)

Produktnummer ABIN629649

Dieses Anti-Asialoglycoprotein Receptor 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Asialoglycoprotein Receptor 1 in WB. Geeignet für Human und Hund.

Kurzübersicht für Asialoglycoprotein Receptor 1 Antikörper (N-Term) (ABIN629649)

Target: Asialoglycoprotein Receptor 1 (ASGR1)

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Asialoglycoprotein Receptor 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Asialoglycoprotein Receptor 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ASGR1 antibody was raised against the N terminal of ASGR1

Aufreinigung: Purified

Immunogen: ASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS

Anwendungsinformationen

Applikationshinweise: WB: 0.6 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASGR1 Blocking Peptide, (ABIN5612187), is also available for use as a blocking control in assays to test for specificity of this ASGR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASGR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Asialoglycoprotein Receptor 1

Target: Asialoglycoprotein Receptor 1 (ASGR1)

Andere Bezeichnung: ASGR1

Hintergrund: ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis