PSME3 Antikörper (C-Term)

Produktnummer ABIN629645

Produktdetails anti-PSME3 Antikörper

Target: PSME3

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSME3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PSME3 antibody was raised against the C terminal of PSME3

Aufreinigung: Purified

Immunogen: PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSME3 Blocking Peptide, catalog no. 33R-9372, is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSME3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSME3

Target: PSME3

Andere Bezeichnung: PSME3 (PSME3 Produkte)

Synonyme: AA410043 antikoerper, AU020960 antikoerper, Ki antikoerper, PA28gamma antikoerper, REGgamma antikoerper, pa28g antikoerper, Ab2-371 antikoerper, PA28-gamma antikoerper, PA28G antikoerper, REG-GAMMA antikoerper, psme3b antikoerper, proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) antikoerper, proteasome activator subunit 3 antikoerper, proteasome activator subunit 3 S homeolog antikoerper, Psme3 antikoerper, PSME3 antikoerper, psme3.S antikoerper

Hintergrund: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Positive Regulation of Endopeptidase Activity, Hepatitis C, Synthesis of DNA