FAM107A Antikörper (Middle Region)

Produktnummer ABIN629643

Dieses Anti-FAM107A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FAM107A in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für FAM107A Antikörper (Middle Region) (ABIN629643)

Target: FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM107A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM107A Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM107 A antibody was raised against the middle region of FAM107

Aufreinigung: Purified

Immunogen: FAM107 A antibody was raised using the middle region of FAM107 corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE

Anwendungsinformationen

Applikationshinweise: WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM107A Blocking Peptide, (ABIN5613460), is also available for use as a blocking control in assays to test for specificity of this FAM107A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM100 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM107A

Target: FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))

Andere Bezeichnung: FAM107A

Hintergrund: When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Molekulargewicht: 17 kDa (MW of target protein)