RSRC2 Antikörper (C-Term)

Produktnummer ABIN629642

Der Kaninchen Polyklonal anti-RSRC2 Antikörper wird verwendet zum Nachweis von RSRC2 in Proben von Human, Maus, Hund und Ratte. Er wurde validiert für WB und IHC.

Kurzübersicht für RSRC2 Antikörper (C-Term) (ABIN629642)

Target: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RSRC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RSRC2 Antikörper

Bindungsspezifität: C-Term

Spezifität: RSRC2 antibody was raised against the C terminal of RSRC2

Aufreinigung: Purified

Immunogen: RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RSRC2 Blocking Peptide, (ABIN937520), is also available for use as a blocking control in assays to test for specificity of this RSRC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSRC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RSRC2

Target: RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))

Andere Bezeichnung: RSRC2

Hintergrund: In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.

Molekulargewicht: 50 kDa (MW of target protein)