WDR12 Antikörper (C-Term)

Produktnummer ABIN629636

Der Kaninchen Polyklonal Anti-WDR12-Antikörper wurde für WB validiert. Er ist geeignet, WDR12 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für WDR12 Antikörper (C-Term) (ABIN629636)

Target: WDR12 (WD Repeat Domain 12 (WDR12))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WDR12 Antikörper

Bindungsspezifität: C-Term

Spezifität: WDR12 antibody was raised against the C terminal of WDR12

Aufreinigung: Purified

Immunogen: WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR12 Blocking Peptide, (ABIN937595), is also available for use as a blocking control in assays to test for specificity of this WDR12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR12

Target: WDR12 (WD Repeat Domain 12 (WDR12))

Andere Bezeichnung: WDR12

Hintergrund: WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.

Molekulargewicht: 47 kDa (MW of target protein)