Cnpase Antikörper (N-Term)

Produktnummer ABIN629627

Produktdetails anti-Cnpase Antikörper

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cnpase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CNP antibody was raised against the N terminal of CNP

Aufreinigung: Purified

Immunogen: CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNP Blocking Peptide, catalog no. 33R-10149, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Andere Bezeichnung: CNP (CNP Produkte)

Synonyme: CNP1 antikoerper, CNPase antikoerper, Cnp-1 antikoerper, Cnp1 antikoerper, CNPF antikoerper, CNPI antikoerper, CNPII antikoerper, CNP antikoerper, DKFZp469F1421 antikoerper, cnpl antikoerper, fd21d08 antikoerper, fi37a10 antikoerper, rich antikoerper, sb:cb662 antikoerper, si:ch73-158e11.4 antikoerper, wu:fd21d08 antikoerper, wu:fd44a05 antikoerper, wu:fi35d08 antikoerper, wu:fi37a10 antikoerper, cnp antikoerper, 2',3'-cyclic nucleotide 3' phosphodiesterase antikoerper, CNP antikoerper, Cnp antikoerper, cnp antikoerper, cnp.L antikoerper

Hintergrund: 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm.

Molekulargewicht: 45 kDa (MW of target protein)