Cnpase Antikörper (N-Term)

Produktnummer ABIN629627

Der Kaninchen Polyklonal Anti-Cnpase-Antikörper wurde für WB validiert. Er ist geeignet, Cnpase in Proben von Human zu detektieren.

Kurzübersicht für Cnpase Antikörper (N-Term) (ABIN629627)

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cnpase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cnpase Antikörper

Bindungsspezifität: N-Term

Spezifität: CNP antibody was raised against the N terminal of CNP

Aufreinigung: Purified

Immunogen: CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNP Blocking Peptide, catalog no. 33R-10149, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Andere Bezeichnung: CNP

Hintergrund: 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm.

Molekulargewicht: 45 kDa (MW of target protein)