POLR2H Antikörper (N-Term)

Produktnummer ABIN629625

Produktdetails anti-POLR2H Antikörper

Target: POLR2H (Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLR2H Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: POLR2 H antibody was raised against the N terminal of POLR2

Aufreinigung: Purified

Immunogen: POLR2 H antibody was raised using the N terminal of POLR2 corresponding to a region with amino acids DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLR2H Blocking Peptide, catalog no. 33R-2043, is also available for use as a blocking control in assays to test for specificity of this POLR2H antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLR2H

Target: POLR2H (Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H))

Andere Bezeichnung: POLR2H (POLR2H Produkte)

Synonyme: RPABC3 antikoerper, RPB17 antikoerper, RPB8 antikoerper, POLR2H antikoerper, RGD1561203 antikoerper, rpb8 antikoerper, rpb17 antikoerper, hsrpb8 antikoerper, rpabc3 antikoerper, zgc:110289 antikoerper, RNA polymerase II subunit H antikoerper, polymerase (RNA) II (DNA directed) polypeptide H antikoerper, polymerase (RNA) II subunit H L homeolog antikoerper, polymerase (RNA) II subunit H antikoerper, info polymerase (RNA) II (DNA directed) polypeptide H antikoerper, POLR2H antikoerper, Polr2h antikoerper, polr2h.L antikoerper, polr2h antikoerper

Hintergrund: This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Regulatorische RNA Pathways