NMNAT1 Antikörper (N-Term)

Produktnummer ABIN629615

Der Kaninchen Polyklonal anti-NMNAT1 Antikörper wird verwendet zum Nachweis von NMNAT1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für NMNAT1 Antikörper (N-Term) (ABIN629615)

Target: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NMNAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NMNAT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: NMNAT1 antibody was raised against the N terminal of NMNAT1

Aufreinigung: Purified

Immunogen: NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NMNAT1 Blocking Peptide, (ABIN5615010), is also available for use as a blocking control in assays to test for specificity of this NMNAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMNAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NMNAT1

Target: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Andere Bezeichnung: NMNAT1

Hintergrund: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.

Molekulargewicht: 32 kDa (MW of target protein)