NMNAT1 Antikörper (N-Term)

Produktnummer ABIN629615

Produktdetails anti-NMNAT1 Antikörper

Target: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NMNAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NMNAT1 antibody was raised against the N terminal of NMNAT1

Aufreinigung: Purified

Immunogen: NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NMNAT1 Blocking Peptide, catalog no. 33R-7409, is also available for use as a blocking control in assays to test for specificity of this NMNAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMNAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NMNAT1

Target: NMNAT1 (Nicotinamide Nucleotide Adenylyltransferase 1 (NMNAT1))

Andere Bezeichnung: NMNAT1 (NMNAT1 Produkte)

Synonyme: id:ibd5068 antikoerper, im:7144541 antikoerper, zgc:110243 antikoerper, LCA9 antikoerper, NMNAT antikoerper, PNAT1 antikoerper, 2610529L11Rik antikoerper, 5730441G13Rik antikoerper, D4Cole1e antikoerper, nmnat antikoerper, nicotinamide mononucleotide adenylyltransferase 1 antikoerper, nicotinamide nucleotide adenylyltransferase 1 antikoerper, CpipJ_CPIJ015320 antikoerper, PTRG_06486 antikoerper, nmnat1 antikoerper, NMNAT1 antikoerper, Nmnat1 antikoerper

Hintergrund: The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.

Molekulargewicht: 32 kDa (MW of target protein)