SWAP70 Antikörper (N-Term)

Produktnummer ABIN629614

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SWAP70 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SWAP70 Antikörper (N-Term) (ABIN629614)

Target: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SWAP70 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SWAP70 Antikörper

Bindungsspezifität: N-Term

Spezifität: SWAP70 antibody was raised against the N terminal of SWAP70

Aufreinigung: Purified

Immunogen: SWAP70 antibody was raised using the N terminal of SWAP70 corresponding to a region with amino acids ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SWAP70 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SWAP70 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SWAP70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SWAP70

Target: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Andere Bezeichnung: SWAP70

Hintergrund: Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response