PEX3 Antikörper (N-Term)

Produktnummer ABIN629613

Dieses Anti-PEX3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PEX3 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für PEX3 Antikörper (N-Term) (ABIN629613)

Target: PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PEX3 Antikörper

Bindungsspezifität: N-Term

Spezifität: PEX3 antibody was raised against the N terminal of PEX3

Aufreinigung: Purified

Immunogen: PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEX3 Blocking Peptide, (ABIN940126), is also available for use as a blocking control in assays to test for specificity of this PEX3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEX3

Target: PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))

Andere Bezeichnung: PEX3

Hintergrund: PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.

Molekulargewicht: 42 kDa (MW of target protein)