PEBP1 Antikörper (C-Term)

Produktnummer ABIN629609

Produktdetails anti-PEBP1 Antikörper

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PEBP1 antibody was raised against the C terminal of PEBP1

Aufreinigung: Purified

Immunogen: PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEBP1

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Andere Bezeichnung: PEBP1 (PEBP1 Produkte)

Synonyme: HCNP antikoerper, HCNPpp antikoerper, PBP antikoerper, PEBP antikoerper, PEBP-1 antikoerper, RKIP antikoerper, pbp antikoerper, hcnp antikoerper, pebp antikoerper, rkip antikoerper, Pbp antikoerper, Pbp1 antikoerper, Pbpr antikoerper, Rkip antikoerper, PEBP1 antikoerper, BcDNA:LP12095 antikoerper, CG18594 antikoerper, Dmel\\CG18594 antikoerper, T2 antikoerper, zgc:56033 antikoerper, zgc:76942 antikoerper, phosphatidylethanolamine binding protein 1 antikoerper, phosphatidylethanolamine binding protein 1 L homeolog antikoerper, phosphatidylethanolamine-binding protein antikoerper, phosphatidylethanolamine-binding protein,putative antikoerper, Phosphatidylethanolamine-binding protein 1 antikoerper, PEBP1 antikoerper, pebp1 antikoerper, Pebp1 antikoerper, pebp1.L antikoerper, RR_RS07785 antikoerper, PVX_235290 antikoerper, PVX_123630 antikoerper, PKH_143640 antikoerper, EAM_1207 antikoerper

Hintergrund: PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Feeding Behaviour