PEBP1 Antikörper (C-Term)

Produktnummer ABIN629609

Der Kaninchen Polyklonal Anti-PEBP1-Antikörper wurde für WB validiert. Er ist geeignet, PEBP1 in Proben von Human und Maus zu detektieren.

Kurzübersicht für PEBP1 Antikörper (C-Term) (ABIN629609)

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PEBP1 Antikörper

Bindungsspezifität: C-Term

Spezifität: PEBP1 antibody was raised against the C terminal of PEBP1

Aufreinigung: Purified

Immunogen: PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEBP1

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Andere Bezeichnung: PEBP1

Hintergrund: PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Feeding Behaviour