BMP2K Antikörper (C-Term)

Produktnummer ABIN629606

Der Kaninchen Polyklonal Anti-BMP2K-Antikörper wurde für WB und IHC validiert. Er ist geeignet, BMP2K in Proben von Human und Hund zu detektieren.

Kurzübersicht für BMP2K Antikörper (C-Term) (ABIN629606)

Target: BMP2K (BMP2 Inducible Kinase (BMP2K))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMP2K Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-BMP2K Antikörper

Bindungsspezifität: C-Term

Spezifität: BMP2 K antibody was raised against the C terminal of BMP2

Aufreinigung: Purified

Immunogen: BMP2 K antibody was raised using the C terminal of BMP2 corresponding to a region with amino acids AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BMP2K Blocking Peptide, (ABIN936834), is also available for use as a blocking control in assays to test for specificity of this BMP2K antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BMP2K

Target: BMP2K (BMP2 Inducible Kinase (BMP2K))

Andere Bezeichnung: BMP2K

Hintergrund: BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning.

Molekulargewicht: 74 kDa (MW of target protein)