CTP Synthase Antikörper (N-Term)

Produktnummer ABIN629603

Der Kaninchen-Polyklonal Anti-CTP Synthase-Antikörper wurde für WB und IHC validiert. Er ist geeignet zum Nachweis von CTP Synthase in Proben aus Human, Maus und Ratte. }

Kurzübersicht für CTP Synthase Antikörper (N-Term) (ABIN629603)

Target: CTP Synthase (CTPS)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTP Synthase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CTP Synthase Antikörper

Bindungsspezifität: N-Term

Spezifität: Ctp Synthase antibody was raised against the N terminal of CTPS

Aufreinigung: Purified

Immunogen: Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ctp Synthase Blocking Peptide, (ABIN5613028), is also available for use as a blocking control in assays to test for specificity of this Ctp Synthase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTPS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTP Synthase

Target: CTP Synthase (CTPS)

Andere Bezeichnung: Ctp Synthase

Hintergrund: The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development and tumorigenesis.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process