CBR1 Antikörper (C-Term)

Produktnummer ABIN629599

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CBR1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für CBR1 Antikörper (C-Term) (ABIN629599)

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CBR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CBR1 Antikörper

Bindungsspezifität: C-Term

Spezifität: Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1

Aufreinigung: Purified

Immunogen: Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonyl Reductase 1 Blocking Peptide, (ABIN5612608), is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CBR1

Target: CBR1 (Carbonyl Reductase 1 (CBR1))

Andere Bezeichnung: Carbonyl Reductase 1

Hintergrund: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.

Molekulargewicht: 30 kDa (MW of target protein)