CBR1 Antikörper (C-Term)
-
- Target Alle CBR1 Antikörper anzeigen
- CBR1 (Carbonyl Reductase 1 (CBR1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CBR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1
- Aufreinigung
- Purified
- Immunogen
- Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
- Top Product
- Discover our top product CBR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-7140, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CBR1 (Carbonyl Reductase 1 (CBR1))
- Andere Bezeichnung
- Carbonyl Reductase 1 (CBR1 Produkte)
- Hintergrund
- Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.
- Molekulargewicht
- 30 kDa (MW of target protein)
-