TCP10L Antikörper

Produktnummer ABIN629595

Der Kaninchen Polyklonal anti-TCP10L Antikörper (ABIN629595) detektiert spezifisch TCP10L in IHC und WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TCP10L Antikörper (ABIN629595)

Target: TCP10L (T-Complex 10-Like (TCP10L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCP10L Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-TCP10L Antikörper

Aufreinigung: Purified

Immunogen: TCP10 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCP10L Blocking Peptide, (ABIN936906), is also available for use as a blocking control in assays to test for specificity of this TCP10L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCP10L

Target: TCP10L (T-Complex 10-Like (TCP10L))

Andere Bezeichnung: TCP10L

Hintergrund: TCP10L is a human leucine zipper protein with transcription inhibition activity.

Molekulargewicht: 24 kDa (MW of target protein)