ICEF1 Antikörper (C-Term)

Produktnummer ABIN629593

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ICEF1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für ICEF1 Antikörper (C-Term) (ABIN629593)

Target: ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICEF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ICEF1 Antikörper

Bindungsspezifität: C-Term

Spezifität: PIP3-E antibody was raised against the C terminal of PIP3-E

Aufreinigung: Purified

Immunogen: PIP3-E antibody was raised using the C terminal of PIP3-E corresponding to a region with amino acids DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIP3-E Blocking Peptide, (ABIN937272), is also available for use as a blocking control in assays to test for specificity of this PIP3-E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP3-E antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ICEF1

Target: ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))

Andere Bezeichnung: PIP3-E

Hintergrund: PIP3-E enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.

Molekulargewicht: 44 kDa (MW of target protein)