ESRP1 Antikörper (N-Term)

Produktnummer ABIN629592

Produktdetails anti-ESRP1 Antikörper

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ESRP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBM35 A antibody was raised against the N terminal of RBM35

Aufreinigung: Purified

Immunogen: RBM35 A antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM35A Blocking Peptide, catalog no. 33R-6542, is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ESRP1

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Andere Bezeichnung: RBM35A (ESRP1 Produkte)

Synonyme: rbm35a antikoerper, RBM35A antikoerper, RMB35A antikoerper, 2210008M09Rik antikoerper, A630065D16 antikoerper, BC031468 antikoerper, Rbm35a antikoerper, RGD1560481 antikoerper, wu:fi28a07 antikoerper, zgc:154050 antikoerper, epithelial splicing regulatory protein 1 antikoerper, epithelial splicing regulatory protein 1 L homeolog antikoerper, ESRP1 antikoerper, esrp1.L antikoerper, Esrp1 antikoerper, esrp1 antikoerper

Hintergrund: RBM35A functions as a tumor suppressor in colon cancer cells.

Molekulargewicht: 68 kDa (MW of target protein)