ESRP1 Antikörper (N-Term)

Produktnummer ABIN629592

Dieses Anti-ESRP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ESRP1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ESRP1 Antikörper (N-Term) (ABIN629592)

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ESRP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ESRP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBM35 A antibody was raised against the N terminal of RBM35

Aufreinigung: Purified

Immunogen: RBM35 A antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM35A Blocking Peptide, (ABIN5615788), is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ESRP1

Target: ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))

Andere Bezeichnung: RBM35A

Hintergrund: RBM35A functions as a tumor suppressor in colon cancer cells.

Molekulargewicht: 68 kDa (MW of target protein)