PHACS Antikörper
-
- Target Alle PHACS (ACCS) Antikörper anzeigen
- PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHACS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC
- Top Product
- Discover our top product ACCS Primärantikörper
-
anti-ACC Synthase-Like Protein 1 (ACCS) (AA 1-100) antibody
ACCS Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 1D2 unconjugated
anti-ACC Synthase-Like Protein 1 (ACCS) (AA 1-501) antibodyACCS Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-ACC Synthase-Like Protein 1 (ACCS) antibodyACCS Reaktivität: Human WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-ACC Synthase-Like Protein 1 (ACCS) (AA 224-250) antibodyACCS Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB38142 unconjugated
anti-ACC Synthase-Like Protein 1 (ACCS) (AA 1-501) antibodyACCS Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-ACC Synthase-Like Protein 1 (ACCS) (AA 301-350) antibodyACCS Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Zebrafisch (Danio rerio), Pferd, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PHACS Blocking Peptide, catalog no. 33R-8217, is also available for use as a blocking control in assays to test for specificity of this PHACS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))
- Andere Bezeichnung
- PHACS (ACCS Produkte)
- Synonyme
- ACS antikoerper, PHACS antikoerper, 2610203E10Rik antikoerper, Phacs antikoerper, RGD1309314 antikoerper, fa10f06 antikoerper, wu:fa10f06 antikoerper, zgc:113217 antikoerper, 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) antikoerper, 1-aminocyclopropane-1-carboxylate synthase (non-functional) antikoerper, 1-aminocyclopropane-1-carboxylate synthase homolog antikoerper, 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) antikoerper, ACCS antikoerper, Accs antikoerper, accs antikoerper
- Hintergrund
- PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.
- Molekulargewicht
- 42 kDa (MW of target protein)
-
