PHACS Antikörper

Produktnummer ABIN629591

Der Kaninchen Polyklonal Anti-PHACS-Antikörper wurde für WB validiert. Er ist geeignet, PHACS in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für PHACS Antikörper (ABIN629591)

Target: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHACS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PHACS Antikörper

Aufreinigung: Purified

Immunogen: PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHACS Blocking Peptide, (ABIN5615340), is also available for use as a blocking control in assays to test for specificity of this PHACS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHACS

Target: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Andere Bezeichnung: PHACS

Hintergrund: PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.

Molekulargewicht: 42 kDa (MW of target protein)