CRYAB Antikörper (C-Term)

Produktnummer ABIN629589

Produktdetails anti-CRYAB Antikörper

Target: CRYAB (Crystallin, alpha B (CRYAB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRYAB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Crystallin Alpha B antibody was raised against the C terminal of CRYAB

Aufreinigung: Purified

Immunogen: Crystallin Alpha B antibody was raised using the C terminal of CRYAB corresponding to a region with amino acids KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Crystallin Alpha B Blocking Peptide, catalog no. 33R-4750, is also available for use as a blocking control in assays to test for specificity of this Crystallin Alpha B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYAB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRYAB

Target: CRYAB (Crystallin, alpha B (CRYAB))

Andere Bezeichnung: Crystallin alpha B (CRYAB Produkte)

Synonyme: CMD1II antikoerper, CRYA2 antikoerper, CTPP2 antikoerper, CTRCT16 antikoerper, HSPB5 antikoerper, MFM2 antikoerper, Crya-2 antikoerper, Crya2 antikoerper, HspB5 antikoerper, AACRYA antikoerper, CRYAB antikoerper, cryab antikoerper, cryab2 antikoerper, wu:fe37f08 antikoerper, zgc:91937 antikoerper, crystallin alpha B antikoerper, crystallin, alpha B antikoerper, hypothetical protein antikoerper, crystallin, alpha B, a antikoerper, crystallin, alpha B, b antikoerper, CRYAB antikoerper, Cryab antikoerper, ZK1128.7 antikoerper, cryaba antikoerper, cryabb antikoerper

Hintergrund: Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone, instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed, alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases, a missense mutation cosegregated in a family with a desmin-related myopathy.

Molekulargewicht: 12 kDa (MW of target protein)