USP16 Antikörper (N-Term)

Produktnummer ABIN629587

Produktdetails anti-USP16 Antikörper

Target: USP16 (Ubiquitin Specific Peptidase 16 (USP16))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser USP16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: USP16 antibody was raised against the N terminal of USP16

Aufreinigung: Purified

Immunogen: USP16 antibody was raised using the N terminal of USP16 corresponding to a region with amino acids CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

USP16 Blocking Peptide, catalog no. 33R-1726, is also available for use as a blocking control in assays to test for specificity of this USP16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu USP16

Target: USP16 (Ubiquitin Specific Peptidase 16 (USP16))

Andere Bezeichnung: USP16 (USP16 Produkte)

Synonyme: ubp-m antikoerper, USP16 antikoerper, UBP-M antikoerper, 1200004E02Rik antikoerper, 2810483I07Rik antikoerper, 6330514E22Rik antikoerper, UBPM antikoerper, si:ch211-238e22.5 antikoerper, si:dkey-121n8.2 antikoerper, wu:fc76b02 antikoerper, wu:fc76b08 antikoerper, universal stress protein antikoerper, ubiquitin specific peptidase 16 antikoerper, ubiquitin specific peptidase 16 L homeolog antikoerper, usp16 antikoerper, USP16 antikoerper, Usp16 antikoerper, usp16.L antikoerper

Hintergrund: USP16 is a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division.

Molekulargewicht: 44 kDa (MW of target protein)